INO80B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• INO80B Polyclonal antibody, PBS Only (29488-1-PBS)

• 

  WB analysis using 29488-1-AP (same clone as 29488-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 29488-1-AP (INO80B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29488-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 29488-1-AP (same clone as 29488-1-PBS)

  WB result of INO80B antibody (29488-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-INO80B transfected HeLa cells. This data was developed using the same antibody clone with 29488-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 29488-1-AP (same clone as 29488-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 29488-1-AP (INO80B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29488-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 29488-1-AP (same clone as 29488-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 29488-1-AP (INO80B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29488-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 29488-1-AP (same clone as 29488-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using INO80B antibody (29488-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 29488-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

INO80B Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 29488-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

29488-1-PBS targets INO80B in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30345

  Product name: Recombinant human INO80B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-265 aa of BC050666

  Sequence: HGHGVHKKKHKKHKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLSGGLGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAATSGRGGRGGARGERRGGRA

• Full Name: INO80 complex subunit B
• Calculated Molecular Weight: 356 aa, 39 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC050666
• Gene Symbol: INO80B
• Gene ID (NCBI): 83444
• RRID: AB_2918316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C086
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

INO80B (INO80 complex subunit B), also known as ZNHIT4 (zinc finger HIT domain-containing protein 4), PAPA1 (PAP-1-associated protein 1), is a subunit of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. INO80B is localized to the nucleolus. The function of INO80B is to induce growth arrest by haulting the cell cycle at the G1 phase. INO80B expression is controlled at the transcriptional level and is highest at the G0 and G1 phases of the cell cycle. In vitro, INO80B binds PAP-1, a splicing factor, and may play a role in nucleolar complexes that regulate ribosome biogenesis and cell cycle events.