INPP5J Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• INPP5J Polyclonal antibody, PBS Only (29949-1-PBS)

• 

  WB analysis using 29949-1-AP (same clone as 29949-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29949-1-AP (INPP5J antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29949-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 29949-1-AP (same clone as 29949-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using INPP5J antibody (29949-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29949-1-PBS in a different storage buffer formulation.

INPP5J Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 29949-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:3.1.3.36, EC:3.1.3.56, Inositol polyphosphate 5-phosphatase J, INPP5, Phosphatidylinositol 1,3,4,5-tetrakisphosphate 5-phosphatase

---

Product Information

29949-1-PBS targets INPP5J in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29242

  Product name: Recombinant human INPP5J protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-150 aa of BC109288

  Sequence: MALPRLGTQSTGPGRCLSPNLQAQEAPAPVTTSSSTSTLSSSPWSAQPTWKSDPGFRITVVTWNVGTAMPPDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFTDQWSELFMDALGPFNFVLVSSVRMQGVILLLFAKYYH

• Full Name: inositol polyphosphate-5-phosphatase J
• Calculated Molecular Weight: 1006 aa, 107 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC109288
• Gene Symbol: INPP5J
• Gene ID (NCBI): 27124
• RRID: AB_2918353
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15735
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

INPP5J(Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A) is also named as PIB5PA, PIPP and belongs to the inositol 1,4,5-trisphosphate 5-phosphatase type II family. INPP5J is a key signalling molecule that regulates dendritic outgrowth through activation of small GTPase signalling via interaction between FRMPD4 and ARHGEF7. It can control the resting membrane potential through a specific ion-channel-receptor-ligand interaction that brings about a large conformational change, analogous to neurotransmitter activation of ion channels at synapses. (PMID:22595022). This protein has 3 isoforms produced by alternative splicing.