INSL3 Polyclonal antibody

• 

  WB analysis using 17997-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 17997-1-AP (INSL3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 17997-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17997-1-AP (INSL3 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 17997-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17997-1-AP (INSL3 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat testis using 17997-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 17997-1-AP (INSL3 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat testis using 17997-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 17997-1-AP (INSL3 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

INSL3 Polyclonal Antibody for WB, ELISA

Cat No. 17997-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Insulin like 3, Insulin-like 3, Insulin-like 3 A chain, Insulin-like 3 B chain, Leydig insulin-like peptide

---

Tested Applications

• Positive WB detected in: human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

17997-1-AP targets INSL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12455

  Product name: Recombinant human INSL3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 17-131 aa of BC071706

  Sequence: LVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAAGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY

• Full Name: insulin-like 3 (Leydig cell)
• Calculated Molecular Weight: 131 aa, 14 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC071706
• Gene Symbol: INSL3
• Gene ID (NCBI): 3640
• RRID: AB_2878479
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51460
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Insulin-like 3 (INSL3), a Leydig cell-specific hormone, is essential for testis descent during foetal life and bone metabolism in adults. Insl3-deficient mice exhibit bilateral undescended testes located high in the abdominal cavity. INSL3 is presumed also to conform to a heterodimeric A-B structure of approximately 6 kDa once released from the producing cells. It is possible that both the mature form of INSL3 (6.6 kDa) and the pro-form(s) of INSL3 (12-14 kDa) are secreted from mammalian Leydig cells (PMID: 19329805).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Exp Mol Pathol; Transcriptomic analysis of the HPT axis in a model of oligoasthenozoospermia induced by Adenine in rats; Authors - Nan Yang
rat	WB	Ecotoxicol Environ Saf; Identification of endocrine-disrupting chemicals targeting the genes and pathways of genital anomalies in males; Authors - Xiang Zhou