INSL3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• INSL3 Polyclonal antibody, PBS Only (17997-1-PBS)

• 

  WB analysis using 17997-1-AP (same clone as 17997-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 17997-1-AP (INSL3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17997-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17997-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17997-1-AP (INSL3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 17997-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17997-1-AP (INSL3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 17997-1-AP (same clone as 17997-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17997-1-AP (INSL3 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17997-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 17997-1-AP (same clone as 17997-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17997-1-AP (INSL3 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17997-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 17997-1-AP (same clone as 17997-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 17997-1-AP (INSL3 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17997-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 17997-1-AP (same clone as 17997-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 17997-1-AP (INSL3 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17997-1-PBS in a different storage buffer formulation.

INSL3 Polyclonal Antibody for WB, ELISA

Cat No. 17997-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Insulin like 3, Insulin-like 3, Insulin-like 3 A chain, Insulin-like 3 B chain, Leydig insulin-like peptide

---

Product Information

17997-1-PBS targets INSL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12455

  Product name: Recombinant human INSL3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 17-131 aa of BC071706

  Sequence: LVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAAGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY

• Full Name: insulin-like 3 (Leydig cell)
• Calculated Molecular Weight: 131 aa, 14 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC071706
• Gene Symbol: INSL3
• Gene ID (NCBI): 3640
• RRID: AB_2878479
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51460
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Insulin-like 3 (INSL3), a Leydig cell-specific hormone, is essential for testis descent during foetal life and bone metabolism in adults. Insl3-deficient mice exhibit bilateral undescended testes located high in the abdominal cavity. INSL3 is presumed also to conform to a heterodimeric A-B structure of approximately 6 kDa once released from the producing cells. It is possible that both the mature form of INSL3 (6.6 kDa) and the pro-form(s) of INSL3 (12-14 kDa) are secreted from mammalian Leydig cells (PMID: 19329805).