INSM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• INSM1 Polyclonal antibody, PBS Only (31681-1-PBS)

• 

  WB analysis using 31681-1-AP (same clone as 31681-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31681-1-AP (INSM1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31681-1-PBS in a different storage buffer formulation.

INSM1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31681-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

IA-1, IA 1, IA1, INSM 1, insulinoma associated 1

---

Product Information

31681-1-PBS targets INSM1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33774

  Product name: Recombinant human INSM1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-230 aa of NM_002196

  Sequence: MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAERAHAALAAALACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSFNLGSPVSAESFPTPAALLGGGGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARGPGPGPPLPPAAALRPPGKRPPPPTAAEPPAKAVKAPGAKKPKAIRKLH*

• Full Name: insulinoma-associated 1
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53-60 kDa
• GenBank Accession Number: NM_002196
• Gene Symbol: INSM1
• Gene ID (NCBI): 3642
• RRID: AB_3670075
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q01101
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Insulinoma-associated-1 (INSM1) is a zinc-finger transcription factor that was originally identified in a human insulinoma subtraction library. INSM1 plays a cardinal role as a transcription factor in the differentiation of embryonic neuroendocrine cells. In situ hybridization studies of human tissues have shown the presence of the INSM1 transcript across various brain regions, as well as in endocrine organs such as the pancreas, adrenal gland, thymus, thyroid, and the endocrine cells of the gastrointestinal tract .(PMID: 34943408, PMID: 36290282)