INSM2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• INSM2 Polyclonal antibody (33151-1-AP)

• 

  WB analysis using 33151-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33151-1-AP (INSM2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

INSM2 Polyclonal Antibody for WB, ELISA

Cat No. 33151-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

IA6, INSM Transcriptional Repressor 2 , Insulinoma-associated protein 2, Nbla106, Zinc finger protein IA-6

---

Tested Applications

• Positive WB detected in: A549 cells, Calu-1 cells, SH-SY5Y cells, SK-N-SH cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33151-1-AP targets INSM2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38945

  Product name: Recombinant human INSM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-210 aa of NM_032594.3

  Sequence: MPRGFLVKRTKRTGGLYRVRLAERVFPLLGPQGAPPFLEEAPSASLPGAERATPPTREEPGKGLTAEAAREQSGSPCRAAGVSPGTGGREGAEWRAGGREGPGPSPSPSPSPAKPAGAELRRAFLERCLSSPVSAESFPGGAAAVAAFSCSVAPAAAPTPGEQFLLPLRAPFPEPALQPDPAPLSAALQSLKRAAGGERRGKAPTDCASG

• Full Name: insulinoma-associated 2
• Calculated Molecular Weight: 59kDa，566aa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: NM_032594.3
• Gene Symbol: INSM2
• Gene ID (NCBI): 84684
• RRID: AB_3742874
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96T92
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

INSM2 (Insulinoma-associated protein 2) is a zinc-finger protein belonging to the transcription factor family and has transcriptional repressive functions. It may exert growth-inhibitory or tumor-suppressive effects in hepatocytes and certain neurons. The primary function of INSM2 involves the regulation of gene expression, particularly the repression of insulin gene expression in non-pancreatic cells. Additionally, INSM2 is upregulated in neuroblastoma and is associated with poor prognosis. It promotes tumor development by affecting lipid metabolism through the regulation of the mTOR signaling pathway.