IPO11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IPO11 Polyclonal antibody, PBS Only (14403-1-PBS)

• 

  WB analysis of human testis using 14403-1-AP (same clone as 14403-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 14403-1-AP (IPO11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14403-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 14403-1-AP (same clone as 14403-1-PBS)

  IP result of anti-IPO11 (IP:14403-1-AP, 4ug; Detection:14403-1-AP 1:1000) with mouse testis tissue lysate 2400 ug. This data was developed using the same antibody clone with 14403-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 14403-1-AP (same clone as 14403-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14403-1-AP (IPO11 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14403-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 14403-1-AP (same clone as 14403-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14403-1-AP (IPO11 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14403-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14403-1-AP (same clone as 14403-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using IPO11 antibody (14403-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 14403-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IPO11 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14403-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

RanBP11, Ran-binding protein 11, Ran binding protein 11, Importin-11, importin 11

---

Product Information

14403-1-PBS targets IPO11 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5659

  Product name: Recombinant human IPO11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC033776

  Sequence: MDLNSASTVVLQVLTQATSQDTAVLKPAEEQLKQWETQPGFYSVLLNIFTNHTLDINVRWLAVLYFKHGIDRYWRRVAPHALSEEEKTTLRAGLITNFNEPINQIATQIAVLIAKVARLDCPRQWPELIPTLIESVKVQDDLRQHRALLTFYHVTKTLASKRLAADRKLFYDLASGIYNFACSLWNHHTDTFLQEVSSGNEAAILSSLERTLLSLKVLRKLTVNGFVEPHKNMEVMGFLHGIFERLKQFLECSRSIGTDNVCRDRLEKTIILFTKVLLDFLDQHPFSFTPLIQRSLEFSVSYVFTEVGEGVTFERFIVQCMNLIKMIVKNYAYKPSKNFEDSSPETLEAH

• Full Name: importin 11
• Calculated Molecular Weight: 113 kDa
• Observed Molecular Weight: 112 kDa
• GenBank Accession Number: BC033776
• Gene Symbol: IPO11
• Gene ID (NCBI): 51194
• RRID: AB_2296214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UI26
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Importins are members of a family of transport receptors (karyopherins) that mediate the nucleocytoplasmic transport of protein and RNA cargoes. Importin-11, is a nuclear import receptor for the ubiquitin-conjugating enzyme, UbcM2.