IPO13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IPO13 Polyclonal antibody (11696-2-AP)

• Featured Product
• KD/KO Validated

IPO13 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11696-2-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

KIAA0724, Karyopherin-13, Karyopherin 13, Kap13, Importin-13

• 

  WB analysis using 11696-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11696-2-AP (IPO13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 11696-2-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11696-2-AP (IPO13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 11696-2-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11696-2-AP (IPO13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa cells using 11696-2-AP

  IF result in Hela cell from Dr. Ralph Kehlenbach showed Nuclear and Cytoplasma stain.

• 

  IF Staining of HeLa using 11696-2-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using IPO13 antibody (11696-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IPO13 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, human brain tissue, Neura-2a cells, mouse lung
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11696-2-AP targets IPO13 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2317

  Product name: Recombinant human IPO13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 614-963 aa of BC008194

  Sequence: ISPYIQQLEKLAEEIPNPSNKLAIVHILGLLSNLFTTLDISHHEDDHEGPELRKLPVPQGPNPVVVVLQQVFQLIQKVLSKWLNDAQVVEAVCAIFEKSVKTLLDDFAPMVPQLCEMLGRMYSTIPQASALDLTRQLVHIFAHEPAHFPPIEALFLLVTSVTLTLFQQGPRDHPDIVDSFMQLLAQALKRKPDLFLCERLDVKSVFQCAVLALKFPEAPTVKASCGFFTELLPRCGEVESVGKVVQEDGRMLLIAVLEAIGGQASRSLMDCFADILFALNKHCFSLLSMWIKEALQPPGFPSARLSPEQKDTFSQQILRERVNKRRVKEMVKEFTLLCRGLHGTDYTADY

• Full Name: importin 13
• Calculated Molecular Weight: 963 aa, 108 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC008194
• Gene Symbol: IPO13
• Gene ID (NCBI): 9670
• RRID: AB_2127672
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94829
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-Importin 13 antibody (Cat# 11696-2-AP) has 6 total citations published in Nature Communications, Redox Biology, Cells, Stem Cells, Journal of Biological Chemistry, and Data Brief. Research fields include oxidative stress transcriptional response, diabetic angiopathy and glycolysis reprogramming, stress-induced cell death, corneal epithelial progenitor cell markers, circadian rhythm regulation, and embryonic stem cell transcriptomics.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF,IP	Nat Commun; Nuclear transporter Importin-13 plays a key role in the oxidative stress transcriptional response.; Authors - K A Gajewska ; KD Validated
	CoIP	Redox Biol; Translocation of SIRT6 promotes glycolysis reprogramming to exacerbate diabetic angiopathy.; Authors - Kemiao Pang
human	WB	Cells; The Nuclear Transporter Importin 13 Can Regulate Stress-Induced Cell Death through the Clusterin/KU70 Axis; Authors - Katarzyna A Gajewska ; KD Validated
human	WB,IHC,IF	Stem Cells; Importin 13 serves as a potential marker for corneal epithelial progenitor cells.; Authors - Wang Hua H
human	WB	J Biol Chem; The nuclear transportation of CHRONO regulates the circadian rhythm; Authors - Qin Zhou
mouse	WB	Data Brief; Transcriptomic profile dataset of embryonic stem cells (Wild-type and IPO13-Knock Out) with and without oxidative stress.; Authors - Katarzyna A Gajewska ; KO Validated