IQGAP1 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of human colon cancer using 85651-1-RR (same clone as 85651-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85651-1-RR (IQGAP1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85651-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 85651-1-RR (same clone as 85651-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using IQGAP1 antibody (85651-1-RR, Clone: 242206G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85651-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 85651-1-RR (same clone as 85651-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using IQGAP1 antibody (85651-1-RR, Clone: 242206G2 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85651-1-PBS in a different storage buffer formulation.

IQGAP1 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 85651-1-PBS

Clone No.242206G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

HUMORFA01, KIAA0051, p195, Ras GTPase-activating-like protein IQGAP1

---

Product Information

85651-1-PBS targets IQGAP1 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19321

  Product name: Recombinant human IQGAP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 478-827 aa of BC151834

  Sequence: QLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRD

• Full Name: IQ motif containing GTPase activating protein 1
• Calculated Molecular Weight: 189 kDa
• GenBank Accession Number: BC151834
• Gene Symbol: IQGAP1
• Gene ID (NCBI): 8826
• ENSEMBL Gene ID: ENSG00000140575
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P46940
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.