IRF1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IRF1 Polyclonal antibody (11335-1-AP)

• Featured Product
• KD/KO Validated

IRF1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 11335-1-AP Copied!

Publications (65)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (6)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA

Synonyms

interferon regulatory factor 1, IRF 1, IRF-1, MAR

• 

  WB analysis using 11335-1-AP

  Western blot analysis of HeLa cells, untreated or treated with Human IFN-γ (hIFN-γ) （HZ-1301） (100 ng/ml, 48 hr), using 11335-1-AP (IRF1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 11335-1-AP

  WB result of IRF1 antibody (11335-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IRF1 transfected HL-60 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11335-1-AP

  IFN gamma treated THP-1 cells were subjected to SDS PAGE followed by western blot with 11335-1-AP (IRF1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 11335-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11335-1-AP (IRF1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11335-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed IFN gamma treated HepG2 cells using IRF1 antibody (11335-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Jurkat using 11335-1-AP

  1X10^6 Jurkat cells were intracellularly stained with 0.5 ug Anti-Human IRF1 (11335-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (green), and 0.5 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with 0.1% TritonX-100.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IRF1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: IFN gamma treated HeLa cells, HL-60 cells, IFN gamma treated THP-1 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: IFN gamma treated HepG2 cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11335-1-AP targets IRF1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig, rabbit, monkey, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1879

  Product name: Recombinant human IRF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-325 aa of BC009483

  Sequence: MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP

• Full Name: IRF 1
• Calculated Molecular Weight: 325 aa, 37 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC009483
• Gene Symbol: IRF1
• Gene ID (NCBI): 3659
• RRID: AB_2877759
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10914
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IRF1, also named as IFN regulatory factor 1, is a 325 amino acid protein, which belongs to the IRF family. IRF1 as a transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. The calculated molecular weight of IRF1 is 37 kDa, but the modified IRF1 protein is about 45-50 kDa.

Publications

What published studies show

The IRF1 polyclonal antibody (Cat# 11335-1-AP) has 65 citations published across 50+ journals including Nature Cell Biology, Cancer Cell, Cell, Gastroenterology, Nature Cancer, Journal of Clinical Investigation, and Frontiers in Immunology. Research fields span oncology and tumor immunotherapy, ferroptosis and cell death, neuroinflammation, viral infections, hepatic injury, pulmonary disease, bone metabolism, and renal pathology.

Automatically generated from the 65 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell; Targeting the immune privilege of tumor-initiating cells to enhance cancer immunotherapy; Authors - Chen Yang
human	WB	Cell; Human IRF1 governs macrophagic IFN-γ immunity to mycobacteria; Authors - Jérémie Rosain
human	WB	Gastroenterology; Stromal Stiffness-Regulated IGF2BP2 in Pancreatic Cancer Drives Immune Evasion via Sphingomyelin Metabolism; Authors - Rong Tang
human	WB	Cancer Commun (Lond); MAGE-C3 promotes cancer metastasis by inducing epithelial-mesenchymal transition and immunosuppression in esophageal squamous cell carcinoma.; Authors - Qingnan Wu
	WB	Cancer Commun (Lond); Targeting autophagy overcomes cancer-intrinsic resistance to CAR-T immunotherapy in B-cell malignancies; Authors - Lu Tang
human	WB	Nat Cancer; A micropeptide encoded by the lncRNA USP30-AS1 promotes tumor growth by attenuating cGAS-STING-type I IFN signaling in macrophages; Authors - Xingwen Wang