• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated IRF1 Polyclonal antibody

IRF1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-11335

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

MAR, IRF-1, IRF 1, interferon regulatory factor 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inIFN gamma treated HepG2 cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11335 targets IRF1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1879

Product name: Recombinant human IRF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-325 aa of BC009483

Sequence: MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP

Predict reactive species
Full Name IRF 1
Calculated Molecular Weight 325 aa, 37 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC009483
Gene Symbol IRF1
Gene ID (NCBI) 3659
RRIDAB_2919026
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10914
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IRF1, also named as IFN regulatory factor 1, is a 325 amino acid protein, which belongs to the IRF family. IRF1 as a transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. The calculated molecular weight of IRF1 is 37 kDa, but the modified IRF1 protein is about 45-50 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 IRF1 antibody CL488-11335Download protocol
IF protocol for CL Plus 488 IRF1 antibody CL488-11335Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human

Sci Adv

XAF1 promotes anti-RNA virus immune responses by regulating chromatin accessibility

Authors - Ming Kuang
Loading...
||
New chat Able
正在加载,请稍候...