CoraLite® Plus 488-conjugated IRF1 Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-11335

  Immunofluorescent analysis of (-20°C Ethanol) fixed IFN gamma treated HepG2 cells using CoraLite® Plus 488 IRF1 antibody (CL488-11335) at dilution of 1:200.

• 

  FC experiment of Jurkat using CL488-11335

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human IRF1 (CL488-11335) (red), or 0.4 ug Mouse IgG1 Isotype Control (CL488-66360, Clone: T1F8D3F10) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

IRF1 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-11335

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

MAR, IRF-1, IRF 1, interferon regulatory factor 1

---

Tested Applications

• Positive IF/ICC detected in: IFN gamma treated HepG2 cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11335 targets IRF1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1879

  Product name: Recombinant human IRF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-325 aa of BC009483

  Sequence: MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP

• Full Name: IRF 1
• Calculated Molecular Weight: 325 aa, 37 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC009483
• Gene Symbol: IRF1
• Gene ID (NCBI): 3659
• RRID: AB_2919026
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10914
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

IRF1, also named as IFN regulatory factor 1, is a 325 amino acid protein, which belongs to the IRF family. IRF1 as a transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. The calculated molecular weight of IRF1 is 37 kDa, but the modified IRF1 protein is about 45-50 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Sci Adv; XAF1 promotes anti-RNA virus immune responses by regulating chromatin accessibility; Authors - Ming Kuang