IRF1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 85254-3-RR (same clone as 85254-3-PBS)

  HeLa untreated and IFN gamma treated cells lysates were subjected to SDS PAGE followed by western blot with 85254-3-RR (IRF1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85254-3-PBS in a different storage buffer formulation.

• 

  WB analysis using 85254-3-RR (same clone as 85254-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85254-3-RR (IRF1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85254-3-PBS in a different storage buffer formulation.

IRF1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85254-3-PBS

Clone No.250167D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

interferon regulatory factor 1, IRF 1, IRF-1, MAR

---

Product Information

85254-3-PBS targets IRF1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1879

  Product name: Recombinant human IRF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-325 aa of BC009483

  Sequence: MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP

• Full Name: IRF 1
• Calculated Molecular Weight: 325 aa, 37 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC009483
• Gene Symbol: IRF1
• Gene ID (NCBI): 3659
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10914
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IRF1, also named as IFN regulatory factor 1, is a 325 amino acid protein, which belongs to the IRF family. IRF1 as a transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. The calculated molecular weight of IRF1 is 37 kDa, but the modified IRF1 protein is about 45-50 kDa.