CoraLite® Plus 488-conjugated IRF5 Monoclonal antibody

IRF5 Monoclonal Antibody for IF/ICC
Cat No. CL488-66835
Clone No.3A4A10

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

IF/ICC

interferon regulatory factor 5, IRF 5, IRF5, SLEB10

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66835 targets IRF5 in IF/ICC applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5442

Product name: Recombinant human IRF5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 173-498 aa of BC004201

Sequence: TLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ

Predict reactive species
Full Name interferon regulatory factor 5
Calculated Molecular Weight 56 kDa
Observed Molecular Weight 56 kDa
GenBank Accession NumberBC004201
Gene Symbol IRF5
Gene ID (NCBI) 3663
RRIDAB_2934498
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13568
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IRF5, also named as SLEB10, contians one IRF tryptophan pentad repeat DNA-binding domain and belongs to the IRF family. It is a transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. It is activated by TLR7 or TLR8 signaling. Genetic variations in IRF5 are associated with susceptibility to inflammatory bowel disease type 14 (IBD14) and systemic lupus erythematosus type 10 (SLEB10). IRF5 is also used as M1 marcrophage lineage marker. Alternative splice variant encoding different isoforms exist.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 IRF5 antibody CL488-66835Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...