IRF6 Polyclonal antibody

• 

  WB analysis using 12928-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12928-1-AP (IRF6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 12928-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 12928-1-AP (IRF6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung using 12928-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 12928-1-AP (IRF6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 12928-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 12928-1-AP (IRF6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 12928-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12928-1-AP (IRF6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 12928-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12928-1-AP (IRF6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 12928-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 12928-1-AP (IRF6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 12928-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 12928-1-AP (IRF6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HaCaT using 12928-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HaCaT cells using IRF6 antibody (12928-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

IRF6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12928-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PIT, OFC6, LPS, IRF-6, IRF 6

---

Tested Applications

• Positive WB detected in: A431 cells, A549 cells, HaCaT cells
• Positive IHC detected in: human lung tissue, mouse kidney tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HaCaT cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12928-1-AP targets IRF6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3623

  Product name: Recombinant human IRF6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 166-467 aa of BC014852

  Sequence: LNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPFYSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLVAPNLIERQKKVKLFCLETFLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ

• Full Name: interferon regulatory factor 6
• Calculated Molecular Weight: 467 aa, 53 kDa
• Observed Molecular Weight: 53-60 kDa
• GenBank Accession Number: BC014852
• Gene Symbol: IRF6
• Gene ID (NCBI): 3664
• RRID: AB_3085402
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14896
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The interferon regulatory factor (IRF) family of genes directs the expression and activity of interferon and thus can strictly regulate innate immunity. Interferon regulatory factor 6 (IRF6) belongs to a family of nine transcription factors that share a highly conserved helix−turn−helix DNA-binding domain and a less conserved protein-binding domain. IRF6 regulates the balance between immature ectoderm differentiation and proliferation during craniofacial morphogenesis. IRF6 functions as a tumor suppressor gene in breast cancer, cervical cancer, nasopharyngeal carcinoma and so on.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Front Pharmacol; Gallic acid mitigates high-fat and high-carbohydrate diet-induced steatohepatitis by modulating the IRF6/PPARγ signaling pathway; Authors - Jiahao Qiu