CoraLite® Plus 647-conjugated IRF6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 647-conjugated IRF6 Polyclonal antibody (CL647-12928)

IRF6 Polyclonal Antibody for IF/ICC

Cat No. CL647-12928

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

interferon regulatory factor 6, IRF 6, IRF-6, LPS, OFC6

• 

  IF Staining of HaCaT using CL647-12928

  Immunofluorescent analysis of (4% PFA) fixed HaCaT cells using CoraLite® Plus 647 IRF6 antibody (CL647-12928) at dilution of 1:200, CL488-Phalloidin (green).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF/ICC detected in: HaCaT cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-12928 targets IRF6 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3623

  Product name: Recombinant human IRF6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 166-467 aa of BC014852

  Sequence: LNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPFYSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLVAPNLIERQKKVKLFCLETFLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ

• Full Name: interferon regulatory factor 6
• Calculated Molecular Weight: 467 aa, 53 kDa
• Observed Molecular Weight: 53-60 kDa
• GenBank Accession Number: BC014852
• Gene Symbol: IRF6
• Gene ID (NCBI): 3664
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14896
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The interferon regulatory factor (IRF) family of genes directs the expression and activity of interferon and thus can strictly regulate innate immunity. Interferon regulatory factor 6 (IRF6) belongs to a family of nine transcription factors that share a highly conserved helix−turn−helix DNA-binding domain and a less conserved protein-binding domain. IRF6 regulates the balance between immature ectoderm differentiation and proliferation during craniofacial morphogenesis. IRF6 functions as a tumor suppressor gene in breast cancer, cervical cancer, nasopharyngeal carcinoma and so on.