IRF8 Monoclonal antibody, PBS Only

• 

  WB analysis using 67142-1-Ig (same clone as 67142-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67142-1-Ig (IRF8 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67142-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 67142-1-Ig (same clone as 67142-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using IRF8 antibody (67142-1-Ig, Clone: 3A10A4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67142-1-PBS in a different storage buffer formulation.

IRF8 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67142-1-PBS

Clone No.3A10A4

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

3A10A4, H-ICSBP, ICSBP1, Interferon consensus sequence-binding protein, interferon regulatory factor 8

---

Product Information

67142-1-PBS targets IRF8 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19909

  Product name: Recombinant human IRF8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 121-426 aa of BC126247

  Sequence: KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV

• Full Name: ICSBP1
• Calculated Molecular Weight: 426 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC126247
• Gene Symbol: IRF8
• Gene ID (NCBI): 3394
• RRID: AB_2882441
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q02556
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IRF8 also named as ICSBP1, is a transcription factor of the IFN regulatory factor (IRF) family. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. IRF8 specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the IFN consensus sequence (ICS)). It plays a negative regulatory role in cells of the immune system. It is predominantly in lymphoid tissues.