IRF8 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• IRF8 Monoclonal antibody (67142-1-Ig)

IRF8 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67142-1-Ig

Clone No.3A10A4

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IF/ICC, CoIP, ELISA

Synonyms

3A10A4, H-ICSBP, ICSBP1, Interferon consensus sequence-binding protein, interferon regulatory factor 8

• 

  WB analysis using 67142-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67142-1-Ig (IRF8 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of THP-1 using 67142-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using IRF8 antibody (67142-1-Ig, Clone: 3A10A4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Ramos cells, Raji cells, Daudi cells
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67142-1-Ig targets IRF8 in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19909

  Product name: Recombinant human IRF8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 121-426 aa of BC126247

  Sequence: KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV

• Full Name: ICSBP1
• Calculated Molecular Weight: 426 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC126247
• Gene Symbol: IRF8
• Gene ID (NCBI): 3394
• RRID: AB_2882441
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q02556
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IRF8 also named as ICSBP1, is a transcription factor of the IFN regulatory factor (IRF) family. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. IRF8 specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the IFN consensus sequence (ICS)). It plays a negative regulatory role in cells of the immune system. It is predominantly in lymphoid tissues.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF,CoIP	Biochem Pharmacol; IRF8 and RUNX1 cooperatively regulate the senescence and damage of urine-derived renal progenitor cells by upregulating LINC01806; Authors - Jie Ma