CoraLite® Plus 488-conjugated IRG1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated IRG1 Recombinant monoclonal antibody (CL488-86725)

IRG1 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-86725

Clone No.251531C12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

ACOD1, CAD

• 

  IF Staining of RAW 264.7 using CL488-86725

  Immunofluorescent analysis of (-20°C Ethanol) fixed untreated or LPS treated RAW 264.7 cells using CoraLite® Plus 488 IRG1 antibody (CL488-86725, Clone: 251531C12 ) at dilution of 1:200.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF/ICC detected in: LPS treated RAW 264.7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86725 targets IRG1 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28913

  Product name: Recombinant human IRG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 285-481 aa of NM_001258406

  Sequence: DAAASVRKHLVAERALLPTDYIKRIVLRIPNVQYVNRPFPVSEHEARHSFQYVACAMLLDGGITVPSFHECQINRPQVRELLSKVELEYPPDNLPSFNILYCEISVTLKDGATFTDRSDTFYGHWRKPLSQEDLEEKFRANASKMLSWDTVESLIKIVKNLEDLEDCSVLTTLLKGPSPPEVASNSPACNNSITNLS

• Full Name: immunoresponsive 1 homolog (mouse)
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: NM_001258406
• Gene Symbol: IRG1
• Gene ID (NCBI): 730249
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: A6NK06
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The host Immune-Responsive Gene 1 (IRG1; also called Acod1) is a mitochondrial enzyme induced under inflammatory conditions that produces the metabolite itaconate by decarboxylating cis-aconitate, a TCA cycle intermediate. Gene expression profiling studies of murine macrophages and microglial cells have revealed that IRG1 is highly expressed under pro-inflammatory conditions. Furthermore, IRG1 is highly expressed in the pregnant uterus during the early events leading to implantation, the specific phase of pregnancy in which high levels of inflammatory cytokines are secreted. IRG1 localizes to the mitochondria and may represent a key link between immunological and metabolic processes. IRG1 has crucial functions in embryonic implantation and neurodegeneration. Also, IRG1 promotes endotoxin tolerance by increasing A20 expression in macrophages via increased ROS production. (PMID: 25640654)