IRGM Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IRGM Polyclonal antibody, PBS Only (25231-1-PBS)

• 

  WB analysis using 25231-1-AP (same clone as 25231-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25231-1-AP (IRGM antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25231-1-PBS in a different storage buffer formulation.

IRGM Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25231-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

IFI1, IRGM1, LRG 47, LRG47

---

Product Information

25231-1-PBS targets IRGM in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18631

  Product name: Recombinant human IRGM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-181 aa of BC128168

  Sequence: MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY

• Full Name: immunity-related GTPase family, M
• Calculated Molecular Weight: 181 aa, 20 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC128168
• Gene Symbol: IRGM
• Gene ID (NCBI): 345611
• RRID: AB_3742142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A1A4Y4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.