ISG20L2 Polyclonal antibody

• 

  WB analysis of HEK-293 using 24639-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24639-1-AP (ISG20L2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 24639-1-AP

  IP result of anti-ISG20L2 (IP:24639-1-AP, 4ug; Detection:24639-1-AP 1:1000) with HEK-293 cells lysate 3240ug.

ISG20L2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 24639-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

EC:3.1.-.-, HSD-38, Interferon-stimulated 20 kDa exonuclease-like 2

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IP detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

24639-1-AP targets ISG20L2 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20026

  Product name: Recombinant human ISG20L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-353 aa of BC000575

  Sequence: MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGTWKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNPPTD

• Full Name: interferon stimulated exonuclease gene 20kDa-like 2
• Calculated Molecular Weight: 353 aa, 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC000575
• Gene Symbol: ISG20L2
• Gene ID (NCBI): 81875
• RRID: AB_2879649
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H9L3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ISG20L2, also named HSD38, is a member of a vertebrate exonucleases family. ISG20L2 is composed of at least two functional domains, one at its N-terminal half allowing intracellular localization and association with the binding partners and the other at its C-terminal half bearing the 3` to 5` exoribonuclease activity. The molecular weight of ISG20L2 is 39 kDa (PMID: 18065403).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	JCI Insight; ISG20L2 suppresses bortezomib anti-myeloma activity by attenuating bortezomib binding to PSMB5; Authors - Yan Yang
human	WB	Nucleic Acids Res; Molecular mechanism of human ISG20L2 for the ITS1 cleavage in the processing of 18S precursor ribosomal RNA; Authors - Yinliang Ma

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Sara (Verified Customer) (05-24-2023)

It is the best ISG20L2 I have tried by far compared to other commercial ones. I have used it for WB (1:5000) and for immunoprecipitation. I need to mention that we tried it for IF but it did not work properly, at least for Jurkat T cells!

• Applications: Western Blot, Immunoprecipitation
• Primary Antibody Dilution: 1:5000