ISG20L2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85992-2-RR (same clone as 85992-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85992-2-RR (ISG20L2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85992-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 85992-2-RR (same clone as 85992-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85992-2-RR (ISG20L2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85992-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 85992-2-RR (same clone as 85992-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ISG20L2 antibody (85992-2-RR, Clone: 250419F5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85992-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 85992-2-RR (same clone as 85992-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using ISG20L2 antibody (85992-2-RR, Clone: 250419F5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85992-2-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 85992-2-RR (same clone as 85992-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using ISG20L2 antibody (85992-2-RR, Clone: 250419F5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85992-2-PBS in a different storage buffer formulation.

ISG20L2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 85992-2-PBS

Clone No.250419F5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EC:3.1.-.-, HSD-38, Interferon-stimulated 20 kDa exonuclease-like 2

---

Product Information

85992-2-PBS targets ISG20L2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20026

  Product name: Recombinant human ISG20L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-353 aa of BC000575

  Sequence: MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGTWKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNPPTD

• Full Name: interferon stimulated exonuclease gene 20kDa-like 2
• Calculated Molecular Weight: 353 aa, 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC000575
• Gene Symbol: ISG20L2
• Gene ID (NCBI): 81875
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H9L3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ISG20L2, also named HSD38, is a member of a vertebrate exonucleases family. ISG20L2 is composed of at least two functional domains, one at its N-terminal half allowing intracellular localization and association with the binding partners and the other at its C-terminal half bearing the 3` to 5` exoribonuclease activity. The molecular weight of ISG20L2 is 39 kDa (PMID: 18065403).