ISOC2 Polyclonal antibody

• 

  WB analysis using 27082-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27082-1-AP (ISOC2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 27082-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 27082-1-AP (ISOC2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 27082-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 27082-1-AP (ISOC2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of LNCaP using 27082-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 27082-1-AP (ISOC2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 27082-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27082-1-AP (ISOC2 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 27082-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27082-1-AP (ISOC2 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human liver using 27082-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27082-1-AP (ISOC2 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 27082-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27082-1-AP (ISOC2 Antibody) at dilution of 1:200 (under 40x lens).

ISOC2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27082-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ISOC2

---

Tested Applications

• Positive WB detected in: LNCaP cells, mouse kidney tissue, mouse liver tissue, mouse testis tissue, rat testis tissue
• Positive IHC detected in: human kidney tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27082-1-AP targets ISOC2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23936

  Product name: Recombinant human ISOC2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 59-205 aa of BC017344

  Sequence: EQYPQGLGPTVPELGTEGLRPLAKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILNTTLDLLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGLILQLVGDAVHPQFKEIQKLIKEPAPDSGLLGLFQGQNSLLH

• Full Name: isochorismatase domain containing 2
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC017344
• Gene Symbol: ISOC2
• Gene ID (NCBI): 79763
• RRID: AB_2880748
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AB3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.