ITGB1BP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ITGB1BP2 Polyclonal antibody (21359-1-AP)

ITGB1BP2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21359-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

CHORDC3, Integrin beta-1-binding protein 2, ITGB1BP, Melusin, MSTP015

• 

  WB analysis of human heart using 21359-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 21359-1-AP (ITGB1BP2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 21359-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 21359-1-AP (ITGB1BP2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 21359-1-AP

  Immunofluorescent analysis of HepG2 cells, using ITGB1BP2 antibody 21359-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human heart tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21359-1-AP targets ITGB1BP2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15808

  Product name: Recombinant human ITGB1BP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-329 aa of BC108901

  Sequence: TVDFSEFLNIKGCTMGPHCAEKLPEAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLDSLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWGKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE

• Full Name: integrin beta 1 binding protein (melusin) 2
• Calculated Molecular Weight: 347 aa, 38 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC108901
• Gene Symbol: ITGB1BP2
• Gene ID (NCBI): 26548
• RRID: AB_10734427
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKP3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ITGB1BP2 (Integrin Subunit Beta 1 Binding Protein 2), also known as Melusin, is a protein-coding gene located on the X chromosome (Xq13.1). It encodes a 347-amino acid protein that is highly conserved, sharing 92% sequence identity with its mouse homolog. The protein is characterized by two cysteine- and histidine-rich (CHORD) domains, PXXP motifs, YXXI/P motifs, putative SH2 and SH3 domain binding motifs, and a C-terminal acidic region that resembles the calcium-binding domains of calreticulin and calsequestrin. Functionally, ITGB1BP2 interacts specifically with the cytoplasmic domain of the beta-1 integrin subunit and is thought to act as a chaperone protein. Its expression is highly restricted, being detected predominantly in skeletal and cardiac muscles, and it is believed to play a crucial role in the maturation and organization of muscle cells. Notably, studies in mouse models have demonstrated that the absence of this gene leads to a failure in cardiac hypertrophy in response to mechanical stress, highlighting its essential role in the heart's adaptive response to biomechanical load.