ITGBL1 Polyclonal antibody

• 

• Featured Product
• KD/KO Validated

ITGBL1 Polyclonal Antibody for ELISA

Cat No. 17484-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Integrin beta like protein 1, ITGBL1, OSCP, TIED

---

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

17484-1-AP targets ITGBL1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11521

  Product name: Recombinant human ITGBL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 145-494 aa of BC036788

  Sequence: NSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP

• Full Name: integrin, beta-like 1 (with EGF-like repeat domains)
• Calculated Molecular Weight: 494 aa, 54 kDa
• GenBank Accession Number: BC036788
• Gene Symbol: ITGBL1
• Gene ID (NCBI): 9358
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95965
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB,IHC,IF	Nat Commun; Primary tumors release ITGBL1-rich extracellular vesicles to promote distal metastatic tumor growth through fibroblast-niche formation.; Authors - Qing Ji
human	WB,IHC	Biomed Pharmacother; Extracellular matrix protein ITGBL1 promotes ovarian cancer cell migration and adhesion through Wnt/PCP signaling and FAK/SRC pathway.; Authors - Li Sun ; KD Validated
human	WB,IHC	Biomed Eng Online; A comprehensive analysis of potential gastric cancer prognostic biomarker ITGBL1 associated with immune infiltration and epithelial-mesenchymal transition.; Authors - Zhe Wang