ITIH1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ITIH1 Polyclonal antibody, PBS Only (21141-1-PBS)

• 

  WB analysis using 21141-1-AP (same clone as 21141-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21141-1-AP (ITIH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21141-1-PBS in a different storage buffer formulation.

ITIH1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21141-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Inter-alpha-inhibitor heavy chain 1, Inter-alpha-trypsin inhibitor complex component III, Inter-alpha-trypsin inhibitor heavy chain H1, Serum-derived hyaluronan-associated protein

---

Product Information

21141-1-PBS targets ITIH1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15598

  Product name: Recombinant human ITIH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 608-811 aa of BC069464

  Sequence: SMSIRGMADQDGLKPTIDKPSEDSPPLEMLGPRRTFVLSALQPSPTHSSSNTQRLPDRVTGVDTDPHFIIHVPQKEDTLCFNINEEPGVILSLVQDPNTGFSVNGQLIGNKARSPGQHDGTYFGRLGIANPATDFQLEVTPQNITLNPGFGGPVFSWRDQAVLRQDGVVVTINKKRNLVVSVDDGGTFEVVLHRVWKGSSVHQD

• Full Name: inter-alpha (globulin) inhibitor H1
• Calculated Molecular Weight: 911 aa, 101 kDa
• Observed Molecular Weight: 70-76 kDa
• GenBank Accession Number: BC069464
• Gene Symbol: ITIH1
• Gene ID (NCBI): 3697
• RRID: AB_3742017
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19827
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ITIH1 (inter-alpha-trypsin inhibitor heavy chain 1), also named as IGHEP1 and SHAP. It is a key component of the inter-alpha-trypsin inhibitor (ITI) family, which plays a crucial role in extracellular matrix (ECM) stabilization and inflammation regulation. ITIH1 forms a complex with bikunin (a light chain) and other heavy chains (ITIH2, ITIH3, ITIH4), contributing to the stabilization of hyaluronan-rich matrices. The calculated molecular weight of the ITIH1 mature form is 101 kDa, but the actual observed molecular weight is about 76 kDa (PMID: 9677337).