ITLN1/2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ITLN1/2 Polyclonal antibody (11770-1-AP)

ITLN1/2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11770-1-AP Copied!

Publications (24)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

ITLN1, HL 1, hIntL, Galactofuranose-binding lectin, Galactofuranose binding lectin

• 

  WB analysis of mouse colon using 11770-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 11770-1-AP (ITLN1/2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse appendix using 11770-1-AP

  IP result of anti-ITLN1/2 (IP:11770-1-AP, 4ug; Detection:11770-1-AP 1:500) with mouse appendix tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 11770-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11770-1-AP (ITLN1/2 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ITLN1/2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse colon tissue
• Positive IP detected in: mouse appendix tissue
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11770-1-AP targets ITLN1/2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2424

  Product name: Recombinant human ITLN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-313 aa of BC020664

  Sequence: MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR

• Full Name: intelectin 1 (galactofuranose binding)
• Calculated Molecular Weight: 313 aa, 35 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC020664
• Gene Symbol: ITLN1
• Gene ID (NCBI): 55600
• RRID: AB_2129677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWA0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ITLN1, also named as Intelectin 1, has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. ITLN1 is a glycoprotein made up of three 40 kDa subunits cross-linked by disulfide bonds making up a 120-kDa homo-trimer of 295 amino acids and N-linked oligosaccharides (PMID: 17621593). It may play a role in the defense system against microorganisms. Human intelectin-1 is expressed in intestinal goblet cells, and is present at about 200 ng/mL in serum. Intelectin-1 was also shown to be expressed in human endothelial cells and adipocytes of human abdominal adipose tissue. (PMID: 22768319,PMID: 28640441)

Publications

What published studies show

The ITLN1/2 Polyclonal antibody (cat. no. 11770-1-AP) has 24 citations. They appear in journals including Nature Communications, Advanced Materials, Science Advances, Journal of Experimental Medicine, International Journal of Biological Sciences, Molecular Medicine, European Journal of Pharmacology, Mucosal Immunology, Journal of Biological Chemistry, and Journal of Proteomics. Research fields span colorectal cancer, ischemic stroke and neuroprotection, inflammation, lectin–microbe interactions, and intestinal biology, using applications such as WB, IF, IHC, IP, and FC.

Automatically generated from the 24 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Mater; Biomimetic Nanomotors for Deep Ischemia Penetration and Ferroptosis Inhibition in Neuroprotective Therapy of Ischemic Stroke; Authors - Rui Wang
	IF	Nat Commun; Tissue mechanics drives regeneration of a mucociliated epidermis on the surface of Xenopus embryonic aggregates.; Authors - Hye Young Kim
	IF	Nat Commun; Mucociliary Wnt signaling promotes cilia biogenesis and beating; Authors - Carina Seidl
mouse	WB	Nat Commun; Intelectin-2 is a broad-spectrum antimicrobial lectin.; Authors - Amanda E. Dugan
human	WB,FC	Sci Adv; Lectin-Seq: A method to profile lectin-microbe interactions in native communities; Authors - Robert L McPherson
human,mouse	WB,IP,IF	Int J Biol Sci; ITLN1 exacerbates Crohn's colitis by driving ZBP1-dependent PANoptosis in intestinal epithelial cells through antagonizing TRIM8-mediated CAPN2 ubiquitination; Authors - Jie Zhao