ITM2B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ITM2B Polyclonal antibody, PBS Only (12193-1-PBS)

• 

  WB analysis using 12193-1-AP (same clone as 12193-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12193-1-AP (ITM2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12193-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12193-1-AP (same clone as 12193-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12193-1-AP (ITM2B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12193-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 12193-1-AP (same clone as 12193-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12193-1-AP (ITM2B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12193-1-PBS in a different storage buffer formulation.

ITM2B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12193-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

ABRI, Bri, BRI2, BRI2 intracellular domain, BRI2, membrane form

---

Product Information

12193-1-PBS targets ITM2B in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2831

  Product name: Recombinant human ITM2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-266 aa of BC016148

  Sequence: MVKVTFNSALAQKETKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS

• Full Name: integral membrane protein 2B
• Calculated Molecular Weight: 266 aa, 30 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC016148
• Gene Symbol: ITM2B
• Gene ID (NCBI): 9445
• RRID: AB_3669134
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y287
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ITM2B plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of the amyloid-beta peptide aggregation and fibrils deposition. It plays a role in the induction of neurite outgrowth and functions as a protease inhibitor by blocking access of secretases to APP cleavage sites.