ITPRIP Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ITPRIP Recombinant monoclonal antibody, PBS Only (88074-2-PBS)

• 

  WB analysis using 88074-2-RR (same clone as 88074-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88074-2-RR (ITPRIP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88074-2-PBS in a different storage buffer formulation.

ITPRIP Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88074-2-PBS

Clone No.260374A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

bA127L20, DANGER, Inositol 1,4,5-trisphosphate receptor-interacting protein, KIAA1754, Protein DANGER

---

Product Information

88074-2-PBS targets ITPRIP in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5612

  Product name: Recombinant human ITPRIP protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 16-83 aa of NM_001272012.2

  Sequence: IINHPLLFPRENATVPENEEEIIRKMQAHQEKLQLEQLRLEEEVARLAAEKEALEQVAEEGRQQNETR

• Full Name: inositol 1,4,5-triphosphate receptor interacting protein
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: NM_001272012.2
• Gene Symbol: ITPRIP
• Gene ID (NCBI): 85450
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IWB1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ITPRIP (inositol 1,4,5-trisphosphate receptor interacting protein) is a key regulatory protein that binds to IP3 receptors to modulate endoplasmic reticulum calcium release and intracellular calcium homeostasis. It is widely expressed in human tissues with high abundance in the central nervous system. ITPRIP participates in neurodevelopment, cell apoptosis, innate immunity and tumor progression. Its abnormal expression is closely linked to glioma malignancy, neurodevelopmental disorders and immune dysfunction, serving as an essential molecule in physiological regulation and disease pathogenesis. (PMID: 29899107)