Tested Applications
| Positive WB detected in | HeLa cells, MDA-MB-453 cells, U-87 MG cells |
| Positive IHC detected in | mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
88074-2-RR targets ITPRIP in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg5612 Product name: Recombinant human ITPRIP protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 16-83 aa of NM_001272012.2 Sequence: IINHPLLFPRENATVPENEEEIIRKMQAHQEKLQLEQLRLEEEVARLAAEKEALEQVAEEGRQQNETR Predict reactive species |
| Full Name | inositol 1,4,5-triphosphate receptor interacting protein |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 62 kDa |
| GenBank Accession Number | NM_001272012.2 |
| Gene Symbol | ITPRIP |
| Gene ID (NCBI) | 85450 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8IWB1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ITPRIP (inositol 1,4,5-trisphosphate receptor interacting protein) is a key regulatory protein that binds to IP3 receptors to modulate endoplasmic reticulum calcium release and intracellular calcium homeostasis. It is widely expressed in human tissues with high abundance in the central nervous system. ITPRIP participates in neurodevelopment, cell apoptosis, innate immunity and tumor progression. Its abnormal expression is closely linked to glioma malignancy, neurodevelopmental disorders and immune dysfunction, serving as an essential molecule in physiological regulation and disease pathogenesis. (PMID: 29899107)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ITPRIP antibody 88074-2-RR | Download protocol |
| WB protocol for ITPRIP antibody 88074-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



