CLNS1A/CLCI Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CLNS1A/CLCI Polyclonal antibody, PBS Only (25964-1-PBS)

• 

  WB analysis of HEK-293 using 25964-1-AP (same clone as 25964-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25964-1-AP (CLNS1A/CLCI antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25964-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDCK using 25964-1-AP (same clone as 25964-1-PBS)

  MDCK cells were subjected to SDS PAGE followed by western blot with 25964-1-AP (CLNS1A/CLCI antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25964-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 25964-1-AP (same clone as 25964-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 25964-1-AP (CLNS1A/CLCI antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25964-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 25964-1-AP (same clone as 25964-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HEK-293 cells using 25964-1-AP (CLNS1A/CLCI antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25964-1-PBS in a different storage buffer formulation.

CLNS1A/CLCI Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25964-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, canine

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CLNS1A, ICln, Chloride conductance regulatory protein ICln (I(Cln)), CLCI

---

Product Information

25964-1-PBS targets CLNS1A/CLCI in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, canine samples.

• Tested Reactivity: human, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22923

  Product name: Recombinant human CLNS1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC119634

  Sequence: MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH

• Full Name: chloride channel, nucleotide-sensitive, 1A
• Calculated Molecular Weight: 237 aa, 26 kDa
• Observed Molecular Weight: 36-42 kDa
• GenBank Accession Number: BC119634
• Gene Symbol: CLNS1A
• Gene ID (NCBI): 1207
• RRID: AB_2880312
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54105
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.