Anti-Mouse IL-28A Rabbit Recombinant Antibody, PBS Only (Capture)

IL-28A Uni-rAb® Recombinant Antibody for FC, Cytometric bead array, Indirect ELISA
Cat No. 98388-1-PBS
Clone No.242247E2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC, Cytometric bead array, Indirect ELISA

Ifnl2, IFN-lambda-2, Il28a, Interferon lambda-2, Interleukin-28A

Formulation:  PBS Only
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

98388-1-PBS targets IL-28A as part of a matched antibody pair:

MP01988-2: 98388-1-PBS capture and 85590-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3169

Product name: Recombinant Mouse IL-28A protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 20-193 aa of NM_001024673.2

Sequence: DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDLRCSSHLFPRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPRSPSRRLSRWLHRLQEAQSKETPGCLEASVTSNLFRLLTRDLKCVANGDQCV

Predict reactive species
Full Name interleukin 28A
Calculated Molecular Weight22 kDa
GenBank Accession NumberNM_001024673.2
Gene Symbol Il28a
Gene ID (NCBI) 330496
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ4VK74
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IL28A, also named as IFNL2 and ZCYT020, is a cytokine with immunomodulatory activity. It up-regulates MHC class I antigen expression. IL28A is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1. The ligand/receptor complex seems to signal through the Jak-STAT pathway. It plays a significant role in the antiviral immune defense in the intestinal epithelium.

Loading...
||
New chat Able
正在加载,请稍候...