Anti-Mouse IL-28A Rabbit Recombinant Antibody

• 

  FC experiment of Transfected HEK-293T using 98388-1-RR

  1x10^6 HEK-293T cells(left) and Il28a-transfected HEK-293T cells(right) were stained with 0.25 ug Anti-Mouse IL-28A Rabbit RecAb (98388-1-RR, Clone:242247E2) and APC-Conjugated Goat Anti-Rabbit IgG(H+L).Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of Transfected HEK-293T using 98388-1-RR

  1x10^6 HEK-293T cells(left) and Il28a-transfected HEK-293T cells(right) were stained with 0.25 ug Anti-Mouse IL-28A Rabbit RecAb (98388-1-RR, Clone:242247E2)(red), or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue) and APC-Conjugated Goat Anti-Rabbit IgG(H+L).Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 98388-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98388-1-RR against Mouse IL-28A were performed. The affinity constant is 0.137 nM.

IL-28A Uni-rAb^® Recombinant Antibody for FC

Cat No. 98388-1-RR

Clone No.242247E2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Ifnl2, IFN-lambda-2, Il28a, Interferon lambda-2, Interleukin-28A

---

Tested Applications

• Positive FC detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98388-1-RR targets IL-28A in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3169

  Product name: Recombinant Mouse IL-28A protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-193 aa of NM_001024673.2

  Sequence: DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDLRCSSHLFPRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPRSPSRRLSRWLHRLQEAQSKETPGCLEASVTSNLFRLLTRDLKCVANGDQCV

• Full Name: interleukin 28A
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: NM_001024673.2
• Gene Symbol: Il28a
• Gene ID (NCBI): 330496
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q4VK74
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

IL28A, also named as IFNL2 and ZCYT020, is a cytokine with immunomodulatory activity. It up-regulates MHC class I antigen expression. IL28A is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1. The ligand/receptor complex seems to signal through the Jak-STAT pathway. It plays a significant role in the antiviral immune defense in the intestinal epithelium.