• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Importin Alpha 5 Monoclonal antibody

Importin Alpha 5 Monoclonal Antibody for FC (Intra)
Cat No. CL488-67897
Clone No.2A7G7

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

FC (Intra)

IMA5, KPNA1, 2A7G7, Impα5, Importin subunit alpha-5, N-terminally processed

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67897 targets Importin Alpha 5 in FC (Intra) applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12751

Product name: Recombinant human KPNA1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 19-272 aa of BC002374

Sequence: LNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLA

Predict reactive species
Full Name karyopherin alpha 1 (importin alpha 5)
Calculated Molecular Weight 60 kDa
Observed Molecular Weight60-62 kDa
GenBank Accession NumberBC002374
Gene Symbol Importin Alpha 5
Gene ID (NCBI) 3836
RRIDAB_2923820
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP52294
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Importins (alpha and beta) are transport factors that transport proteins into the nucleus. alpha importins function by binding transcription factors at nuclear localization sequences (NLS), and associating with importin beta subunits to translocate through the nuclear pore. Six isoforms of alpha importins have been described in human. Importin alpha 5 is the predominant importin in adult CNS and is essential for differentiation and viability of neural cells.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Importin Alpha 5 antibody CL488-67897Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...