Importin Beta Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Importin Beta Recombinant monoclonal antibody, PBS Only (86630-3-PBS)

• Featured Product
• KD/KO Validated

Importin Beta Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86630-3-PBS

Clone No.251633D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

KPNB1, IMB1, Impnb, Importin 90, Importin subunit beta 1

• 

  WB analysis using 86630-3-RR (same clone as 86630-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86630-3-RR (KPNB1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86630-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 86630-3-RR (same clone as 86630-3-PBS)

  WB result of Importin Beta antibody (86630-3-RR; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Importin Beta transfected HeLa cells. This data was developed using the same antibody clone with 86630-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 86630-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86630-3-RR against Human Importin Beta were performed. The affinity constant is 1.02 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86630-3-PBS targets Importin Beta in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0122

  Product name: Recombinant human KPNB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 409-612 aa of BC003572

  Sequence: AMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLL

• Full Name: karyopherin (importin) beta 1
• Calculated Molecular Weight: 97 kDa
• Observed Molecular Weight: 90-97 kDa
• GenBank Accession Number: BC003572
• Gene Symbol: KPNB1
• Gene ID (NCBI): 3837
• RRID: AB_3745020
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14974
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Importin beta1, also known karyopherin beta or KPNB1, is a nuclear transport receptor that plays a key role in the nuclear import process. Importin beta1 and importin alpha work in concert to transport cargo into the nucleus, functioning as an essential component of the classical nuclear localization signal (NLS) pathway. Elevated expression of importin beta1 has been found in cervical tumors. (22125623)