CoraLite® Plus 488-conjugated Ins1 Recombinant monoclonal antibody

Ins1 Uni-rAb® Recombinant Antibody for IF-P
Cat No. CL488-83867
Clone No.240798G4

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

IF-P

Insulin, insulin1, 240798G4, Ins 1, Ins-1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse pancreas tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83867 targets Ins1 in IF-P applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29988

Product name: Recombinant mouse insulin1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-87 aa of NM_008386

Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKR

Predict reactive species
Full Name insulin I
Calculated Molecular Weight 12 kDa
Observed Molecular Weight12 kDa
GenBank Accession NumberNM_008386
Gene Symbol Ins1
Gene ID (NCBI) 16333
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01325
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Insulin 1 is a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Ins1 antibody CL488-83867Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...