Integrin Alpha V Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84883-5-RR (same clone as 84883-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84883-5-RR (Integrin Alpha V antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84883-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocellular cancer using 84883-5-RR (same clone as 84883-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocellular cancer slide using 84883-5-RR (Integrin Alpha V antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84883-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocellular cancer using 84883-5-RR (same clone as 84883-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocellular cancer slide using 84883-5-RR (Integrin Alpha V antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84883-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 84883-5-RR (same clone as 84883-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84883-5-RR (Integrin Alpha V antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84883-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 84883-5-RR (same clone as 84883-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84883-5-RR (Integrin Alpha V antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84883-5-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 84883-5-RR (same clone as 84883-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using Integrin Alpha V antibody (84883-5-RR, Clone: 242376D3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84883-5-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 84883-5-RR (same clone as 84883-5-PBS)

  1x10^6 A549 cells were surface stained with 0.25 ug Integrin Alpha V Recombinant monoclonal antibody (84883-5-RR, Clone: 242376D3) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Cells were not fixed. This data was developed using the same antibody clone with 84883-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84883-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84883-5-RR against Human Integrin Alpha V were performed. The affinity constant is 0.121 nM.

Integrin Alpha V Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC, Indirect ELISA

Cat No. 84883-5-PBS

Clone No.242376D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC, Indirect ELISA

Synonyms

ITGAV, 242376D3, CD51, Integrin alpha-V, Integrin alpha-V heavy chain

---

Product Information

84883-5-PBS targets Integrin Alpha V in WB, IHC, IF/ICC, FC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25825

  Product name: Recombinant human ITGAV protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 819-915 aa of BC136442

  Sequence: SFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQ

• Full Name: integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51)
• Calculated Molecular Weight: 1048 aa, 116 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC136442
• Gene Symbol: Integrin alpha V
• Gene ID (NCBI): 3685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P06756
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha V, also known as CD51, is a type I transmembrane glycoprotein composed of an extracellular domain, a transmembrane region and cytoplasmic domain (PMID: 2430295; 1690718). It can form heterodimers with one of the five beta integrin subunits (beta 1, 3, 5, 6, 8) that recognize ligands containing the sequence Arg-Gly-Asp, such as vitronectin, fibronectin, and osteopontin (PMID: 37087799). Integrin alpha V mainly plays a role in extracellular matrix-mediated cell adhesion and migration, differentiation, wound healing, inflammation, tumorigenesis, proliferation, angiogenesis, and metastasis.