• Featured Product
  • KD/KO Validated

Integrin Alpha V Recombinant monoclonal antibody

Integrin Alpha V Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC, ELISA
Cat No. 84883-5-RR
Clone No.242376D3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC, ELISA

ITGAV, 242376D3, CD51, Integrin alpha-V, Integrin alpha-V heavy chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, mouse kidney tissue, HUVEC cells, MCF-7 cells, human placenta tissue, rat kidney
Positive IHC detected inhuman hepatocellular cancer, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells
Positive FC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84883-5-RR targets Integrin Alpha V in WB, IHC, IF/ICC, FC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25825

Product name: Recombinant human ITGAV protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 819-915 aa of BC136442

Sequence: SFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQ

Predict reactive species
Full Name integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51)
Calculated Molecular Weight 1048 aa, 116 kDa
Observed Molecular Weight130 kDa
GenBank Accession NumberBC136442
Gene Symbol Integrin alpha V
Gene ID (NCBI) 3685
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP06756
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha V, also known as CD51, is a type I transmembrane glycoprotein composed of an extracellular domain, a transmembrane region and cytoplasmic domain (PMID: 2430295; 1690718). It can form heterodimers with one of the five beta integrin subunits (beta 1, 3, 5, 6, 8) that recognize ligands containing the sequence Arg-Gly-Asp, such as vitronectin, fibronectin, and osteopontin (PMID: 37087799). Integrin alpha V mainly plays a role in extracellular matrix-mediated cell adhesion and migration, differentiation, wound healing, inflammation, tumorigenesis, proliferation, angiogenesis, and metastasis.

Protocols

Product Specific Protocols
FC protocol for Integrin Alpha V antibody 84883-5-RRDownload protocol
IF protocol for Integrin Alpha V antibody 84883-5-RRDownload protocol
IHC protocol for Integrin Alpha V antibody 84883-5-RRDownload protocol
WB protocol for Integrin Alpha V antibody 84883-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...