CD49b Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CD49b Polyclonal antibody, PBS Only (30703-1-PBS)

• 

  WB analysis using 30703-1-AP (same clone as 30703-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30703-1-AP (Integrin alpha 2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30703-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30703-1-AP (same clone as 30703-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30703-1-AP (Integrin alpha-2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30703-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 30703-1-AP (same clone as 30703-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 30703-1-AP (Integrin alpha 2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30703-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 30703-1-AP (same clone as 30703-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using ITGA2 antibody (30703-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30703-1-PBS in a different storage buffer formulation.

CD49b Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30703-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ITGA2, BR, Collagen receptor, GPIa, Integrin alpha 2

---

Product Information

30703-1-PBS targets CD49b in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32771

  Product name: Recombinant human ITGA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 840-1132 aa of NM_002203

  Sequence: GIVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIVHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCNADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPT

• Full Name: integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
• Calculated Molecular Weight: 126 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: NM_002203
• Gene Symbol: Integrin alpha 2
• Gene ID (NCBI): 3673
• RRID: AB_3669752
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17301
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha-2 (ITGA2, CD49b) combines with the beta 1 subunit (ITGB1, CD29) to form a cell-surface receptor (VLA-2) for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin.