Integrin alpha 6 Monoclonal antibody

• 

  WB analysis of A431 using 66906-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 66906-1-Ig (Integrin alpha-6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of JAR using 66906-1-Ig

  JAR cells were subjected to SDS PAGE followed by western blot with 66906-1-Ig (Integrin Alpha 6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 66906-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 66906-1-Ig (Integrin Alpha 6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

Integrin alpha 6 Monoclonal Antibody for WB, ELISA

Cat No. 66906-1-Ig

Clone No.2B12A1

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, ELISA

Synonyms

ITGA6, 2B12A1, CD49 antigen-like family member F, CD49f, Integrin alpha-6

---

Tested Applications

• Positive WB detected in: A431 cells, JAR cells, human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66906-1-Ig targets Integrin alpha 6 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25866

  Product name: Recombinant human Integrin alpha-6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 477-690 aa of BC136456

  Sequence: TPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTK

• Full Name: integrin, alpha 6
• Calculated Molecular Weight: 1073 aa, 119 kDa
• Observed Molecular Weight: 115-120 kDa
• GenBank Accession Number: BC136456
• Gene Symbol: Integrin alpha 6
• Gene ID (NCBI): 3655
• RRID: AB_2882233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23229
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha 6 (ITGA6, also known as CD49f or VLA-6) is a 120-kDa single-pass type 1 transmembrane glycoprotein, which combines with the beta 1 subunit (ITGB1, CD29) or beta 4 subunit (ITGB4, CD104) to form heterodimeric laminin receptors (PMID: 1976638; 2351695). Integrin alpha 6 mediates cell-to-cell and cell-to-stroma adhesion. It has also been found in many different stem cell populations and is involved in homing and connecting stem cells to their niches and regulating self-renewal mechanisms in stem cells (PMID: 28494695).