Use Able AI chat for product recommendations

Integrin alpha 6 Monoclonal antibody, PBS Only

Integrin alpha 6 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66906-1-PBS
Clone No.2B12A1

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, Indirect ELISA

ITGA6, 2B12A1, CD49 antigen-like family member F, CD49f, Integrin alpha-6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66906-1-PBS targets Integrin alpha 6 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25866

Product name: Recombinant human Integrin alpha-6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 477-690 aa of BC136456

Sequence: TPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTK

Predict reactive species
Full Name integrin, alpha 6
Calculated Molecular Weight 1073 aa, 119 kDa
Observed Molecular Weight 115-120 kDa
GenBank Accession NumberBC136456
Gene Symbol Integrin alpha 6
Gene ID (NCBI) 3655
RRIDAB_2882233
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP23229
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha 6 (ITGA6, also known as CD49f or VLA-6) is a 120-kDa single-pass type 1 transmembrane glycoprotein, which combines with the beta 1 subunit (ITGB1, CD29) or beta 4 subunit (ITGB4, CD104) to form heterodimeric laminin receptors (PMID: 1976638; 2351695). Integrin alpha 6 mediates cell-to-cell and cell-to-stroma adhesion. It has also been found in many different stem cell populations and is involved in homing and connecting stem cells to their niches and regulating self-renewal mechanisms in stem cells (PMID: 28494695).

Loading...
||
New chat

Able

正在加载,请稍候...