Use Able AI chat for product recommendations

Integrin alpha-9 Polyclonal antibody, PBS Only

Integrin alpha-9 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28348-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

ITGA9, ALPHA RLC, Integrin alpha 9, Integrin alpha RLC, Integrin alpha-RLC

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

28348-1-PBS targets Integrin alpha-9 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28815

Product name: Recombinant human Integrin alpha-9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 462-613 aa of BC030198

Sequence: VITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPEEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMGQVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQ

Predict reactive species
Full Name integrin, alpha 9
Calculated Molecular Weight 114 kDa
Observed Molecular Weight140-150 kDa
GenBank Accession NumberBC030198
Gene Symbol Integrin alpha 9
Gene ID (NCBI) 3680
RRIDAB_3669655
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13797
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits (PMID: 9779984). Integrin alpha 9 contains a large N-terminal extracellular domain with 7 conserved repeats of putative metal-binding domains, a transmembrane segment, and a short C-terminal cytoplasmic tail (PMID: 8245132). Integrin alpha 9 interacts with integrin beta 1, generating α9β1 heterodimer, which is expressed in many cell types, including epithelial cells, neutrophils, hepatocytes, muscle, and endothelial cells (PMID: 21975548). It binds to a diversity of ligands in the extracellular matrix, like the a-disintegrin and metalloprotease (ADAM) family, THBS1, EMILIN1, VEGF, tenascin-C, osteopontin, fibronectin, and VCAM1 (PMID: 21975548; 33790909). Integrin α9β1 has been implicated in diverse biological functions, including angiogenesis, lymphangiogenesis, lymphatic valve morphogenesis, granulopoiesis and tumorigenesis (PMID: 20179422).

Loading...
||
New chat

Able

正在加载,请稍候...