Intersectin 1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Intersectin 1 Polyclonal antibody, PBS Only (21862-1-PBS)

• 

  WB analysis of fetal human brain using 21862-1-AP (same clone as 21862-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 21862-1-AP (Intersectin 1 antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21862-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 21862-1-AP (same clone as 21862-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal stomach slide using 21862-1-AP (Intersectin 1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21862-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 21862-1-AP (same clone as 21862-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal stomach slide using 21862-1-AP (Intersectin 1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21862-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 21862-1-AP (same clone as 21862-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 21862-1-AP (Intersectin 1 antibody) at dilution of 1:50 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21862-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 21862-1-AP (same clone as 21862-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 21862-1-AP (Intersectin 1 antibody) at dilution of 1:50 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21862-1-PBS in a different storage buffer formulation.

Intersectin 1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21862-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

ITSN1, SH3 domain-containing protein 1A, ITSN 1, ITSN, Intersectin-1

---

Product Information

21862-1-PBS targets Intersectin 1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16517

  Product name: Recombinant human ITSN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 610-926 aa of BC116186

  Sequence: LREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQEAQDKLGRLFHQHQEPAKPAVQAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTGEPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTSSEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQGEKVEGLQAQALYPWRA

• Full Name: intersectin 1 (SH3 domain protein)
• Calculated Molecular Weight: 1721 aa, 195 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC116186
• Gene Symbol: Intersectin 1
• Gene ID (NCBI): 6453
• RRID: AB_2878931
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15811
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Intersectin 1 (ITSN1) is a multidomain adaptor protein that plays a crucial role in various cellular processes, particularly in the nervous system. It is involved in clathrin-mediated endocytosis, signal transduction, and the regulation of the actin cytoskeleton. The protein is highly abundant in neurons and has been implicated in neurodevelopmental disorders, such as autism spectrum disorders, intellectual disability, and epilepsy. Recent studies have identified de novo variants in the ITSN1 gene in patients with these disorders, suggesting a link between ITSN1 and brain development.