Islet 2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Islet 2 Polyclonal antibody, PBS Only (18659-1-PBS)

• 

  WB analysis of Neuro-2a using 18659-1-AP (same clone as 18659-1-PBS)

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 18659-1-AP (Islet 2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18659-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Neuro-2a using 18659-1-AP (same clone as 18659-1-PBS)

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 18659-1-AP (ISL2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18659-1-PBS in a different storage buffer formulation.

Islet 2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18659-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

18659-1-PBS targets Islet 2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13333

  Product name: Recombinant human ISL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-359 aa of BC012136

  Sequence: MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET

• Full Name: ISL LIM homeobox 2
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC012136
• Gene Symbol: ISL2
• Gene ID (NCBI): 64843
• RRID: AB_2878556
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96A47
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.