JAGN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• JAGN1 Polyclonal antibody, PBS Only (34193-1-PBS)

• 

  WB analysis using 34193-1-AP (same clone as 34193-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 34193-1-AP (JAGN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 34193-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 34193-1-AP (same clone as 34193-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 34193-1-AP (JAGN1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 34193-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 34193-1-AP (same clone as 34193-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 34193-1-AP (JAGN1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 34193-1-PBS in a different storage buffer formulation.

JAGN1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 34193-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Protein jagunal homolog 1

---

Product Information

34193-1-PBS targets JAGN1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40789

  Product name: Recombinant human JAGN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-39 aa of BC032101

  Sequence: MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKK

• Full Name: jagunal homolog 1 (Drosophila)
• Calculated Molecular Weight: 183 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC032101
• Gene Symbol: JAGN1
• Gene ID (NCBI): 84522
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N5M9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Jagunal homolog 1 (JAGN1) is an evolutionarily conserved endoplasmic reticulum (ER) membrane protein essential for neutrophil differentiation and function. First identified in Drosophila for its role in ER organization, human JAGN1 mutations cause severe congenital neutropenia type 5, characterized by recurrent infections due to impaired granulocyte development. JAGN1 regulates glycoprotein folding, ER-Golgi trafficking, and N-glycosylation of proteins critical for neutrophil viability. Loss of JAGN1 leads to ER stress, apoptosis of myeloid progenitors, and defective neutrophil migration. Its indispensable role in innate immunity highlights JAGN1 as a potential therapeutic target for neutropenia and immunodeficiency disorders (PMID: 25129144; 37120535; 33207009; 38739706).