Mouse JAM-A/CD321 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86229-1-RR (same clone as 86229-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86229-1-RR (F11r(CD321) antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86229-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86229-1-RR (same clone as 86229-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86229-1-RR (F11r(CD321) antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86229-1-PBS in a different storage buffer formulation.

• 

  IF Staining of bEnd.3 using 86229-1-RR (same clone as 86229-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed bEnd.3 cells using JAM-A/CD321 antibody (86229-1-RR, Clone: 250060H5 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86229-1-PBS in a different storage buffer formulation.

JAM-A/CD321 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86229-1-PBS

Clone No.250060H5

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CD321, F11r, Jam1, JAM-1, JAM-A

---

Product Information

86229-1-PBS targets JAM-A/CD321 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3117

  Product name: Recombinant Mouse JAM-A/Junctional Adhesion Molecule A protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-238 aa of NM_172647.2

  Sequence: KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGG

• Full Name: F11 receptor
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: NM_172647.2
• Gene Symbol: F11r
• Gene ID (NCBI): 16456
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O88792
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Junctional Adhesion Molecule-A (JAM-A), also known as CD321 or F11R, is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. It is primarily located in the tight junctions of epithelial and endothelial cells and is also expressed on circulating platelets and leukocytes (PMID: 34533648). Targeting F11R/JAM-A with monoclonal antibodies or peptide antagonists has shown promise in inhibiting tumor growth and metastasis in mouse models (PMID: 37563645).