JIP1/IB-1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• JIP1/IB-1 Polyclonal antibody (14568-1-AP)

JIP1/IB-1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14568-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

MAPK8IP1, Islet-brain 1, Islet brain 1, IB-1, IB1

• 

  WB analysis of fetal human brain using 14568-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 14568-1-AP (JIP1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 14568-1-AP

  IP result of anti-JIP1/IB-1 (IP:14568-1-AP, 4ug; Detection:14568-1-AP 1:500) with mouse brain tissue lysate 1840 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of rat brain using 14568-1-AP

  IP result of anti-JIP1/IB-1 (IP:14568-1-AP, 4ug; Detection:14568-1-AP 1:500) with rat brain tissue lysate 1120 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 14568-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 14568-1-AP (JIP1/IB-1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 14568-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 14568-1-AP (JIP1/IB-1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 14568-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 14568-1-AP (JIP1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 14568-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14568-1-AP (JIP1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 14568-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 14568-1-AP (JIP1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 14568-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14568-1-AP (JIP1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 14568-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 14568-1-AP (JIP1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 14568-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 14568-1-AP (JIP1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of PC-12 using 14568-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed PC-12 cells using JIP1/IB-1 antibody (14568-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for JIP1/IB-1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: fetal human brain tissue
• Positive IP detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human oesophagus cancer tissue, mouse brain tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14568-1-AP targets JIP1/IB-1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6150

  Product name: Recombinant human JIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 366-711 aa of BC068470

  Sequence: SLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVSSPYESAIGEEYEEAPRPQPPACLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCIINGEEQEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEINVRGVKIGVKADDSQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADNRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE

• Full Name: mitogen-activated protein kinase 8 interacting protein 1
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 97-116 kDa
• GenBank Accession Number: BC068470
• Gene Symbol: MAPK8IP1/IB-1
• Gene ID (NCBI): 9479
• RRID: AB_2281682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UQF2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The JIP1/IB-1 polyclonal antibody (Cat# 14568-1-AP) has 10 citations published across journals including Metabolism, Journal of Nanobiotechnology, Science of the Total Environment, Cell Reports, Current Biology, Biochemical Pharmacology, ACS Chemical Neuroscience, Frontiers in Physiology, Saudi Pharmaceutical Journal, and Oncotarget. Research fields span diabetes-associated cognitive impairment, acute lung injury, neurotoxicity, aging, axonal development, bone loss, diabetic nephropathy, cerebral ischemia-reperfusion injury, and glioma.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Metabolism; Setmelanotide alleviates diabetes-associated cognitive impairment by interrupting the binding of ICAM-1 and JIP1 in endothelial cells of the blood-brain barrier.; Authors - Shi-Di Wu
mouse	IF	J Nanobiotechnology; Synergistic anti-oxidative/anti-inflammatory treatment for acute lung injury with selenium based chlorogenic acid nanoparticles through modulating Mapk8ip1/MAPK and Itga2b/PI3k-AKT axis; Authors - Huizhen Xing
mouse	IF	Sci Total Environ; Manganese disrupts the maturation and degradation of axonal autophagosome leading to hippocampal synaptic toxicity in mice via the activation of LRRK2 on phosphorylation of Rab10; Authors - Zhuo Ma
mouse	WB	Cell Rep; SFRS11 Loss Leads to Aging-Associated Cognitive Decline by Modulating LRP8 and ApoE.; Authors - Obayed Raihan
mouse	WB	Curr Biol; Stretch triggers microtubule stabilization and MARCKS-dependent membrane incorporation in the shaft of embryonic axons; Authors - Sara C Sousa
mouse, human	WB,IP	Biochem Pharmacol; Spautin-1 inhibits osteoclast differentiation and attenuates bone loss by blocking USP10/JIP1-mediated JNK pathway.; Authors - Xinyi Chen