JPH1 Polyclonal antibody

• 

  WB analysis of HEK-293 using 25979-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25979-1-AP (JPH1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25979-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25979-1-AP (JPH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skeletal muscle using 25979-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 25979-1-AP (JPH1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 25979-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 25979-1-AP (JPH1 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human skin using 25979-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 25979-1-AP (JPH1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human skin using 25979-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 25979-1-AP (JPH1 antibody) at dilution of 1:200 (under 40x lens).

JPH1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25979-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

JP 1, JP1, JPH1, junctophilin 1, Junctophilin type 1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse heart tissue, rat heart tissue
• Positive IHC detected in: human skeletal muscle tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25979-1-AP targets JPH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23270

  Product name: Recombinant human JPH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 464-639 aa of BC140875

  Sequence: RSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKRSVADEQVTAIVNKPLMSKAPTKEAGAVVPQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPSKSVTKPVAKESKAEPKAKKSELAIPKNPASNDSCPALEKEANSGPNS

• Full Name: junctophilin 1
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC140875
• Gene Symbol: JPH1
• Gene ID (NCBI): 56704
• RRID: AB_2880317
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HDC5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Junctophilin-1 is a protein that in humans is encoded by the JPH1 gene. This gene is a member of the junctophilin gene family. Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. The protein encoded by this gene is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane.