• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated JUN Polyclonal antibody

JUN Polyclonal Antibody for IF/ICC
Cat No. CL488-24909

Host / Isotype

Rabbit / IgG

Reactivity

human, hamster, mouse

Applications

IF/ICC

Activator protein 1, AP 1, AP1, c Jun, JUN, jun oncogene, P39, Proto oncogene c Jun, Transcription factor AP 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-24909 targets JUN in IF/ICC applications and shows reactivity with human, hamster, mouse samples.

Tested Reactivity human, hamster, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17639

Product name: Recombinant human JUN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 92-227 aa of BC068522

Sequence: PTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKE

Predict reactive species
Full Name jun oncogene
Calculated Molecular Weight 331 aa, 36 kDa
Observed Molecular Weight 39 kDa
GenBank Accession NumberBC068522
Gene Symbol JUN
Gene ID (NCBI) 3725
RRIDAB_3084086
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05412
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

JUN is also named as c-Jun and AP1, belongs to the bZIP family and Jun subfamily. JUN, the most extensively studied protein of the activator protein-1 (AP-1) complex, is involved in numerous cell activities, such as proliferation, apoptosis, survival, tumorigenesis and tissue morphogenesis[PMID: 22180088]. JUN is a transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. It promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. JUN is a basic leucine zipper (bZIP) transcription factor that acts as homo- or heterodimer, binding to DNA and regulating gene transcription[PMID: 9732876]. In additon, extracellular signals can induce post-translational modifications of JUN, resulting in altered transcriptional activity and target gene expression[PMID:8464713]. More over, it has uncovered multiple layers of a complex regulatory scheme in which JUN is able to crosstalk, amplify and integrate different signals for tissue development and disease. Jun is predominantly nuclear, ubiquitinated Jun colocalizes with lysosomal proteins[PMID: 15469925]. This antibody is a rabbit polyclonal antibody raised against a region of human JUN. Both phosphorylated (p-c-Jun) and unphosphorylated forms of c-Jun, with sizes of 42-45 kDa and 36-39 kDa, respectively are obtain in some experiments. (PMID: 17210646)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 JUN antibody CL488-24909Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...