Tested Applications
| Positive WB detected in | A431 cells, HeLa cells, human heart tissue, T-47D cells, mouse heart tissue, rat heart tissue |
| Positive IP detected in | HT-29 cells |
| Positive IHC detected in | human pancreas cancer tissue, human breast cancer tissue, human colon cancer tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11146-1-AP targets Gamma Catenin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1627 Product name: Recombinant human JUP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 396-745 aa of BC011865 Sequence: LVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDLDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA Predict reactive species |
| Full Name | junction plakoglobin |
| Calculated Molecular Weight | 82 kDa |
| Observed Molecular Weight | 82 kDa |
| GenBank Accession Number | BC011865 |
| Gene Symbol | Gamma Catenin |
| Gene ID (NCBI) | 3728 |
| RRID | AB_2265007 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14923 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Plakoglobin (γ-catenin), a member of the Armadillo proteins, plays important roles in cell adhesion with α-catenin and β-catenin, is involved in Wnt signaling, and is translocated into the nucleus and binds LEF1. Plakoglobin is a major cytoplasmic component of both desmosomes and adherens junctions, and is the only known constituent common to submembranous plaques in both of these structures, which are located at the intercalated disc (ICD) of cardiomyocytes. Plakoglobin links cadherins to the actin cytoskeleton. Mutations in plakoglobin are associated with arrhythmogenic right ventricular dysplasia and Pemphigus vulgaris.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Gamma Catenin antibody 11146-1-AP | Download protocol |
| IP protocol for Gamma Catenin antibody 11146-1-AP | Download protocol |
| WB protocol for Gamma Catenin antibody 11146-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Gamma Catenin (Plakoglobin) polyclonal antibody (Cat# 11146-1-AP) has 11 citations across journals including J Clin Invest, Genome Biol, Oncogene, Cell Reports, J Adv Res, Anal Chem, Int J Mol Sci, Drug Dev Res, Biol Reprod, PLoS One, and Biochem Biophys Res Commun. Research fields span cancer biology (breast, ovarian, lung, pancreatic), cardiac gap junction assembly, epithelial-to-mesenchymal transition, wound healing in diabetes, embryo implantation, and podocyte cytoskeletal dynamics.
| Species | Application | Title |
|---|---|---|
J Adv Res OTUD1 delays wound healing by regulating endothelial function and angiogenesis in diabetic mice | ||
J Clin Invest The FOXN3-NEAT1-SIN3A repressor complex promotes progression of hormonally responsive breast cancer. | ||
Genome Biol Ubiquitination degradation of GATA4 by CUL4B promotes ovarian cancer metastasis by inducing lysosomal acidification. | ||
Oncogene Loss of giant obscurins from breast epithelium promotes epithelial-to-mesenchymal transition, tumorigenicity and metastasis. | ||
Cell Rep CYLD deubiquitinates plakoglobin to promote Cx43 membrane targeting and gap junction assembly in the heart | ||
Anal Chem TROP2 Promotes Tumor Cell Migration through Downregulation of DSG2 Revealed by Super-Resolution Fluorescence Imaging. |



























