Gamma Catenin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Gamma Catenin Polyclonal antibody (11146-1-AP)

Gamma Catenin Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11146-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

JUP, JUP/gamma Catenin, γ-Catenin, ARVD12, Catenin gamma

• 

  WB analysis using 11146-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11146-1-AP (Gamma Catenin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11146-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11146-1-AP (Plakoglobin/gamma catenin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 11146-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11146-1-AP (Plakoglobin/gamma catenin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HT-29 using 11146-1-AP

  IP result of anti-Gamma Catenin (IP:11146-1-AP, 4ug; Detection:11146-1-AP 1:1000) with HT-29 cells lysate 1040 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 11146-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11146-1-AP (Plakoglobin/gamma catenin antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human bowen disease using 11146-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 11146-1-AP (Gamma Catenin antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human bowen disease using 11146-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 11146-1-AP (Gamma Catenin antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human bowen disease using 11146-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 11146-1-AP (Gamma Catenin antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11146-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 11146-1-AP (Plakoglobin/gamma catenin antibody at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11146-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 11146-1-AP (Plakoglobin/gamma catenin antibody at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 11146-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin slide using 11146-1-AP (Plakoglobin/gamma catenin antibody at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 11146-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin slide using 11146-1-AP (Plakoglobin/gamma catenin antibody at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 11146-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 11146-1-AP (Plakoglobin/gamma catenin antibody at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 11146-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 11146-1-AP (Plakoglobin/gamma catenin antibody at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Gamma Catenin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, human heart tissue, T-47D cells, mouse heart tissue, rat heart tissue
• Positive IP detected in: HT-29 cells
• Positive IHC detected in: human pancreas cancer tissue, human breast cancer tissue, human colon cancer tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11146-1-AP targets Gamma Catenin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1627

  Product name: Recombinant human JUP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 396-745 aa of BC011865

  Sequence: LVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDLDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA

• Full Name: junction plakoglobin
• Calculated Molecular Weight: 82 kDa
• Observed Molecular Weight: 82 kDa
• GenBank Accession Number: BC011865
• Gene Symbol: Gamma Catenin
• Gene ID (NCBI): 3728
• RRID: AB_2265007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14923
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Plakoglobin (γ-catenin), a member of the Armadillo proteins, plays important roles in cell adhesion with α-catenin and β-catenin, is involved in Wnt signaling, and is translocated into the nucleus and binds LEF1. Plakoglobin is a major cytoplasmic component of both desmosomes and adherens junctions, and is the only known constituent common to submembranous plaques in both of these structures, which are located at the intercalated disc (ICD) of cardiomyocytes. Plakoglobin links cadherins to the actin cytoskeleton. Mutations in plakoglobin are associated with arrhythmogenic right ventricular dysplasia and Pemphigus vulgaris.

Publications

What published studies show

The Gamma Catenin (Plakoglobin) polyclonal antibody (Cat# 11146-1-AP) has 11 citations across journals including J Clin Invest, Genome Biol, Oncogene, Cell Reports, J Adv Res, Anal Chem, Int J Mol Sci, Drug Dev Res, Biol Reprod, PLoS One, and Biochem Biophys Res Commun. Research fields span cancer biology (breast, ovarian, lung, pancreatic), cardiac gap junction assembly, epithelial-to-mesenchymal transition, wound healing in diabetes, embryo implantation, and podocyte cytoskeletal dynamics.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Adv Res; OTUD1 delays wound healing by regulating endothelial function and angiogenesis in diabetic mice; Authors - Jiajia Zhang
human	WB	J Clin Invest; The FOXN3-NEAT1-SIN3A repressor complex promotes progression of hormonally responsive breast cancer.; Authors - Wanjin Li
human	WB	Genome Biol; Ubiquitination degradation of GATA4 by CUL4B promotes ovarian cancer metastasis by inducing lysosomal acidification.; Authors - Xin Yin
mouse	WB	Oncogene; Loss of giant obscurins from breast epithelium promotes epithelial-to-mesenchymal transition, tumorigenicity and metastasis.; Authors - M Shriver
rat,mouse	WB,IP,IF	Cell Rep; CYLD deubiquitinates plakoglobin to promote Cx43 membrane targeting and gap junction assembly in the heart; Authors - Wei Xie
human	WB,IF	Anal Chem; TROP2 Promotes Tumor Cell Migration through Downregulation of DSG2 Revealed by Super-Resolution Fluorescence Imaging.; Authors - Longxiang Li