Jagged1/CD339 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Jagged1/CD339 Monoclonal antibody (66890-1-Ig)

• Featured Product
• KD/KO Validated

Jagged1/CD339 Monoclonal Antibody for WB, ELISA

Cat No. 66890-1-Ig Copied!

Clone No. 2A7D11

Publications (24)

Download datasheet

Host / Isotype

Mouse / IgA

Reactivity

human and More (3)

Applications

WB, IHC, IF, ELISA

Synonyms

JAG1, Jagged1, 2A7D11, CD339, HJ1

• 

  WB analysis of HEK-293 using 66890-1-Ig

  WB result of Jagged1 antibody (66890-1-Ig; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Jagged1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-29 using 66890-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 66890-1-Ig (Jagged1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Jagged1/CD339 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HT-29 cells

Mouse monoclonal antibodies of IgA isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66890-1-Ig targets Jagged1/CD339 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, goat
• Host / Isotype: Mouse / IgA
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11891

  Product name: Recombinant human Jagged1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 35-350 aa of BC098393

  Sequence: FELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGS

• Full Name: jagged 1 (Alagille syndrome)
• Calculated Molecular Weight: 1218 aa, 134 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC098393
• Gene Symbol: Jagged1
• Gene ID (NCBI): 182
• RRID: AB_2882220
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Thiophilic affinity chromatograph
• UNIPROT ID: P78504
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Jagged1 is a type I, membrane- anchored, multidomain protein and a ligand of the Notch receptor. The receptor-ligand interaction can trigger the Notch signaling and activate transcription factors that play key roles in cell differentiation and morphogenesis. The predicted MW of Jagged1 is 134 kDa, while higher MW around 150-180 kDa had been observed in literations (PMID: 9716576, 9596653).

Publications

What published studies show

Anti-JAG1 (Jagged 1) antibody, catalog number 66890-1-Ig, has 24 citations across journals including Advanced Science, Cell Reports Medicine, Cell Reports, Cell Death Discovery, Cell Systems, Frontiers in Immunology, Molecular Oncology, Journal of Gastroenterology, BMC Pregnancy and Childbirth, and Life Science Alliance. Research fields span oncology (hepatocellular, colorectal, glioma, renal cell carcinoma), Notch signaling, immunology, preeclampsia, vascular biology, and stem cell biology.

Automatically generated from the 24 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); The Loss of an Orphan Nuclear Receptor NR2E3 Augments Wnt/β-catenin Signaling via Epigenetic Dysregulation that Enhances Sp1-β catenin-p300 Interactions in Hepatocellular Carcinoma; Authors - Yuet-Kin Leung
mouse	IF	Cell Rep Med; LIFUS-driven engineered bacteria reprogram immunosuppressive niches via mechano-NOTCH signaling.; Authors - Lizhou Lin
human	WB	Int J Biol Sci; Linc-KILH potentiates Notch1 signaling through inhibiting KRT19 phosphorylation and promotes the malignancy of hepatocellular carcinoma.; Authors - Xudong Zhang
goat	WB	Cell Death Discov; Molecular mechanism underlying miR-204-5p regulation of adipose-derived stem cells differentiation into cells from three germ layers; Authors - Zhimin Wang
		Cell Rep; Jagged1(+) Tregs mediate lymphatic remodeling in tumor-draining lymph nodes.; Authors - Jessie Z. Xu
human	WB	Cell Syst; Dynamic decoding of VEGF signaling and coordinated control of multiple phenotypes by the Src-TEM4-YAP pathway; Authors - Sung Hoon Lee